PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100115520081
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family BES1
Protein Properties Length: 259aa    MW: 27999.8 Da    PI: 9.1995
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100115520081genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822173.98.3e-54111821134
                        DUF822  21 rRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslqsslkss 101
                                   rRRaiaakiyaGLRaqGny lpk++DnneVlkALc+eAGw+ve+DGttyrkg+kp   +e++g+s++++p+ss + s+ ss
  Ote100115520081|100115520081   1 RRRAIAAKIYAGLRAQGNYDLPKHCDNNEVLKALCNEAGWIVEPDGTTYRKGCKPI-PMEIGGTSTNITPSSSRNPSPPSS 80 
                                   8*******************************************************.************************ PP

                        DUF822 102 alaspvesysaspksssfpspssldsislasa.....a 134
                                   ++asp++sy++sp+sssfpsps+ d + ++++     +
  Ote100115520081|100115520081  81 YFASPIPSYQPSPSSSSFPSPSRHDPNASSHPfafllN 118
                                   *************************9988755544441 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056873.5E-501106IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
RRRAIAAKIY AGLRAQGNYD LPKHCDNNEV LKALCNEAGW IVEPDGTTYR KGCKPIPMEI  60
GGTSTNITPS SSRNPSPPSS YFASPIPSYQ PSPSSSSFPS PSRHDPNASS HPFAFLLNSI  120
PSSLPSLRIS SSAPVTPPLS SPTRVPKQTF TLETLAKESM SALNIPFFAA SAPASPTRVQ  180
RFTPVPIPEC DESDSSTADS GRWMNFQPYT NAGNMVPTSP TFNLVKPVAQ PVPSMDAVSD  240
XXXXXXXXXX XSLTLRVWR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009767052.11e-127PREDICTED: protein BRASSINAZOLE-RESISTANT 1-like
SwissprotQ8S3079e-90BZR1_ARATH; Protein BRASSINAZOLE-RESISTANT 1
TrEMBLA0A068UH771e-119A0A068UH77_COFCA; Uncharacterized protein
TrEMBLK4BV771e-119K4BV77_SOLLC; Uncharacterized protein
TrEMBLM1CP011e-120M1CP01_SOLTU; Uncharacterized protein
STRINGSolyc04g079980.2.11e-119(Solanum lycopersicum)
STRINGPGSC0003DMT4000715851e-119(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28122454